Primary Information |
|---|
| BoMiProt ID | Bomi10154 |
|---|
| Protein Name | Tumor suppressor candidate 3/Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit TUSC3/Oligosaccharyl transferase subunit TUSC3/Magnesium uptake/transporter TUSC3 |
|---|
| Organism | Bos taurus |
|---|
| Uniprot ID | Q32L57 |
|---|
| Milk Fraction | Whey,Casein |
|---|
| Ref Sequence ID | NP_001074383.1 |
|---|
| Aminoacid Length | 347 |
|---|
| Molecular Weight | 39536 |
|---|
| FASTA Sequence |
Download |
|---|
| Gene Name | TUSC3 |
|---|
| Gene ID | 615007 |
|---|
| Protein Existence Status | reviewed |
|---|
Secondary Information |
|---|
| Protein Function | prevents the epithelial-to-mesenchymal transition and inhibits tumor growth by modulating the endoplasmic reticulum stress response in ovarian cancer cells |
|---|
| Biochemical Properties | TUSC3 is an Mg2+ -transporter involved in magnesium transport and homeostasis, which is important for learning and memory, embryonic development and testis maturation. |
|---|
| PTMs | Methylation and Glycosylation |
|---|
Site(s) of PTM(s)
N-glycosylation,
O-glycosylation,
Phosphorylation
| >sp|Q32L57|TUSC3_BOVIN Tumor suppressor candidate 3 OS=Bos taurus OX=9913 GN=TUSC3 PE=2 SV=1
MGARGAPSRRRQAGRRPRYLPTGSFPFLLLLLLLCIQLGGGQKKKENLLAEKVEQLMEWS
SRRSVFRMNGDKFRKFIKAPPRN*83YSMIVMFTALQPQRQCSVCRLANEEYQILANSWRYSS
AFCNKLFFSKVDYDEGTDIFQQLNINSAPTFMHFPPKGRPKRADTFDLQRIGFGAEQLAK
WIADRTDVHIRVFRPPNYSGTIALALLVSLVGGLLYLRRNNLEFIYNKTGWAMVSLCIVF
AMTSGQMWNHIRGPPYAHKNPHNGQVSYIHGSSQVQFVAESHIILVLNAAITMGMDLLNE
AATSKGDVGKRRIICLVGLGLVVFFFSFLLSIFRSKYHGYPYSFLIK
|
|---|
| Predicted Disorder Regions | (1-17) |
|---|
| DisProt Annotation | |
|---|
| TM Helix Prediction | 5TMHs; (20-42),(199-217),(230-248),(283-301),(314-332) |
|---|
| Significance of PTMs | Epigenetic silencing of TUSC3 has been associated with poor prognosis, and hypermethylation of its promoter provides an independent biomarker of overall and disease-free survival in ovarian cancer patients. |
|---|
| Bibliography | 1.Kratochvílová K, Horak P, Ešner M, Souček K, Pils D, Anees M, Tomasich E, Dráfi F, Jurtíková V, Hampl A, Krainer M, Vaňhara P. Tumor suppressor candidate 3 (TUSC3) prevents the epithelial-to-mesenchymal transition and inhibits tumor growth by modulating the endoplasmic reticulum stress response in ovarian cancer cells. Int J Cancer. 2015 Sep 15;137(6):1330-40. doi: 10.1002/ijc.29502. Epub 2015 Mar 21. PMID: 25735931. 2.Yu X, Zhai C, Fan Y, Zhang J, Liang N, Liu F, Cao L, Wang J, Du J. TUSC3: a novel tumour suppressor gene and its functional implications. J Cell Mol Med. 2017 Sep;21(9):1711-1718. doi: 10.1111/jcmm.13128. Epub 2017 Mar 8. PMID: 28272772; PMCID: PMC5571513. |
|---|
