Primary Information |
|---|
| BoMiProt ID | Bomi3857 |
|---|
| Protein Name | Aminoacyl tRNA synthase complex-interacting multifunctional protein 2/Multisynthase complex auxiliary component p38/Protein JTV-1 |
|---|
| Organism | Bos taurus |
|---|
| Uniprot ID | Q0II26 |
|---|
| Milk Fraction | Whey |
|---|
| Ref Sequence ID | NP_001069281.1 |
|---|
| Aminoacid Length | 320 |
|---|
| Molecular Weight | 35178 |
|---|
| FASTA Sequence |
Download |
|---|
| Gene Name | AIMP2/JTV1 |
|---|
| Gene ID | 520979 |
|---|
| Protein Existence Status | reviewed |
|---|
Secondary Information |
|---|
| Protein Function | is required for assembly and stability of the aminoacyl-tRNA synthase complex.role in the aggregation of α-synuclein in mice.Blocks MDM2-mediated ubiquitination and degradation of p53/TP53. Functions as a proapoptotic factor.But a splicing variant of AIMP2 lacking exon 2, referred to as AIMP2-DX2, is oncogenic and compromises the pro-apoptotic activity of AIMP2 by competing with it for p53 and TRAF2. |
|---|
| Biochemical Properties | is a homodimer with interaction speculated to be mediated by the C Terminal GST domain.While its splice variant DX2 seems to be in a dynamic equilibrium between the monomer and dimer in solution state. |
|---|
| PTMs | Phosphorylation,Ubl conjugation |
|---|
Site(s) of PTM(s)
N-glycosylation,
O-glycosylation,
Phosphorylation
| >sp|Q0II26|AIMP2_BOVIN Aminoacyl tRNA synthase complex-interacting multifunctional protein 2 OS=Bos taurus OX=9913 GN=AIMP2 PE=2 SV=1
MPMYQVKPYHEGSGSLRVELPTCMYRLPNVHGRTGPAPSADHVQEASDPSLQALESHQD
DILKRLYELKAAVDGLSKMIQTPDADLDVTNIIQADEPAALSTSTVDLNAMLGQDHGALK
DIVINANPASPPLSLLVLHRLLCDHYKVLSSVHTHSAVRSVPANLLQCFGEQTRQQPRHE
YQLGFTLIWKDVPKTQMKFSVQTMCPIEGEGNIARFLFSLFGQKQDAVNLTLIDSWVDIA
IFQLKEGSSKEKAAVFRSMNSALGKTPWLVGDELTVADVVLWSVLRQTGGCGGMAPANVQ
KWMQACENLAPFHTALKLLQ
|
|---|
| Predicted Disorder Regions | 4-12, 28-56 |
|---|
| DisProt Annotation | |
|---|
| TM Helix Prediction | No TM helices |
|---|
| Significance of PTMs | Upon DNA damage, AIMP2 was phosphorylated on Serine residue by JNk, dissociated from the multi-tRNA synthetase complex, and translocated into the nuclei of cells. AIMP2 directly interacts with p53, thereby preventing MDM2-mediated ubiquitination and degradation of p53.Both unphosphorylated and phosphorylated AIMP2 bound to p53 have similar affinities. |
|---|
| Additional Comments | AIMP2 knockdown ameliorated the α-synuclein aggregation and dopaminergic cell death in response to PFF or 6-hydroxydopamine treatment. |
|---|
| Bibliography | 1.Jha R, Cho HY, Mushtaq AU, Lee K, Kim DG, Kim S, Jeon YH. Purification and biophysical characterization of the AIMP2-DX2 protein. Protein Expr Purif. 2017 Apr;132:131-137. doi: 10.1016/j.pep.2017.02.002. Epub 2017 Feb 7. PMID: 28185908. 2.Han JM, Park BJ, Park SG, Oh YS, Choi SJ, Lee SW, Hwang SK, Chang SH, Cho MH, Kim S. AIMP2/p38, the scaffold for the multi-tRNA synthetase complex, responds to genotoxic stresses via p53. Proc Natl Acad Sci U S A. 2008 Aug 12;105(32):11206-11. doi: 10.1073/pnas.0800297105. Epub 2008 Aug 11. PMID: 18695251; PMCID: PMC2516205. |