Primary Information |
|---|
| BoMiProt ID | Bomi4556 |
|---|
| Protein Name | CCHC-type zinc finger nucleic acid binding protein |
|---|
| Organism | Bos taurus |
|---|
| Uniprot ID | Q3T0Q6 |
|---|
| Milk Fraction | Exosomes |
|---|
| Ref Sequence ID | NP_001029396.1 |
|---|
| Aminoacid Length | 170 |
|---|
| Molecular Weight | 18742 |
|---|
| FASTA Sequence |
Download |
|---|
| Gene Name | CNBP |
|---|
| Protein Existence Status | reviewed |
|---|
Secondary Information |
|---|
| Protein Function | is conserved in eukaryotes and is essential for embryonic development in mammals.CNBP preferentially bound G-rich elements in the target mRNA coding sequences, most of which were previously found to form G-quadruplex and other stable structures in vitro. Functional analyses, including RNA sequencing, ribosome profiling, and quantitative mass spectrometry, revealed that CNBP binding did not influence target mRNA abundance but rather increased their translational efficiency. |
|---|
| Biochemical Properties | Binds G-rich elements in target mRNA coding sequences.Prevents G-quadruplex structure formation in vitro, suggesting a role in supporting translation by resolving stable structures on mRNAs.CNBP amino acid sequences show a putative Pro-Glu-Ser-Thr site of proteolysis and several putative phosphorylation sites. |
|---|
| PTMs | Acetylation, Methylation, Phosphorylation |
|---|
Site(s) of PTM(s)
N-glycosylation,
O-glycosylation,
Phosphorylation
| >sp|Q3T0Q6|CNBP_BOVIN CCHC-type zinc finger nucleic acid binding protein OS=Bos taurus OX=9913 GN=CNBP PE=2 SV=1
MSSNECFKCGRSGHWARECPTGGGRGRGMRSRGRGFQFVSSS*42LPDICYRCGESGHLAKDC
DLQEDACYNCGRGGHIAKDCKEPKREREQCCYNCGKPGHLARDCDHADEQKCYSCGEFGH
IQKDCTKVKCYRCGETGHVAINCSKTSEVNCYRCGESGHLARECTIEATA
|
|---|
| Predicted Disorder Regions | 1-12, 18-38, 46-104, 108-142, 154-156, 161-166 |
|---|
| DisProt Annotation | |
|---|
| TM Helix Prediction | No TM helices |
|---|
| Significance of PTMs | Acetylation, Methylation, Phosphorylation |
|---|
| Bibliography | 1.Benhalevy, D., Gupta, S. K., Danan, C. H., Ghosal, S., Sun, H. W., Kazemier, H. G., Paeschke, K., Hafner, M., & Juranek, S. A. (2017). The Human CCHC-type Zinc Finger Nucleic Acid-Binding Protein Binds G-Rich Elements in Target mRNA Coding Sequences and Promotes Translation. Cell reports, 18(12), 2979–2990. https://doi.org/10.1016/j.celrep.2017.02.080 |