Primary Information |
|---|
| BoMiProt ID | Bomi5385 |
|---|
| Protein Name | E3 ubiquitin-protein ligase TRIM11/RING-type E3 ubiquitin transferase TRIM11/Tripartite motif-containing protein 11 |
|---|
| Organism | Bos taurus |
|---|
| Uniprot ID | A0JN74 |
|---|
| Milk Fraction | Whey,MFGM |
|---|
| Ref Sequence ID | NP_001071388.1 |
|---|
| Aminoacid Length | 468 |
|---|
| Molecular Weight | 52947 |
|---|
| FASTA Sequence |
Download |
|---|
| Gene Name | TRIM11 |
|---|
| Gene ID | 514580 |
|---|
| Protein Existence Status | reviewed |
|---|
Secondary Information |
|---|
| Protein Function | TRIM11 binds to both the proteasome and USP14, a deubiquitinase that prematurely removes ubiquitins from proteasome-bound substrates and also noncatalytically inhibits the proteasome, and precludes their association, thereby increasing proteasome activity.enhances degradation of aberrant and normal regulatory proteins, and augments overall rate of proteolysis. |
|---|
| Biochemical Properties | characterized by an N-terminal TRIM/RBCC motif comprising a RING domain, one or two B-Boxes, and a predicted coiled-coil region, which is followed by a more diverse C-terminal region. RING domain is required for interaction with USP14.composed of a C-terminal PRY-SPRY (PS) motif. |
|---|
| PTMs | phosphorylation on Ser |
|---|
Site(s) of PTM(s)
N-glycosylation,
O-glycosylation,
Phosphorylation
| >sp|A0JN74|TRI11_BOVIN E3 ubiquitin-protein ligase TRIM11 OS=Bos taurus OX=9913 GN=TRIM11 PE=2 SV=1
MAAPDLSTNLQEEATCAICLDYFTDPVMTDCGHNFCRECIRRCWGQPEGPYACPECRELF
PQRNLRPNRPLAKMAEMARRLHPPS*85PVPQGVCAAHREPLAAFCGDELRLLCAACERSGEH
WAHRVRPLQDAAEDLKSKLEKSLEHLRKQMEDALLFQAQAEETCSLWQKMVETQRQNVLT
EFERLRRLLVEEEQLLLQRLEEEELEVLPPLRESAARLGQQSAQLAELITELEGRCQLPA
LGLLQDIRDTLRRVQDVKLQPPEVVPMEMRTVCRVPGLVEALRRFRGDMTLDPDTANPEL
VLSEDRRSVRRGDLRQALPDSPERFDPGPCVLGREPLTSGRHYWEVEVGERASWALGVCR
ENANRKEKGELFAGNGFWILVFLGSYYNSSERAFAPLRDPPRRVGIFLDYEAGHLSFYSA
NDGSLLYTFPETPFSGTLRALFSPLSSSPTPMTICRLKGGPGDGLAPQ |
|---|
| Predicted Disorder Regions | NA |
|---|
| DisProt Annotation | |
|---|
| TM Helix Prediction | no TM helices |
|---|
| Additional Comments | promotes cell survival and is upregulated upon heat shock.upregulation of TRIM11 and other TRIMs may contribute to an enhanced cellular capacity to remove misfolded proteins in tumor cell. |
|---|
| Bibliography | Chen L, Zhu G, Johns EM, Yang X. TRIM11 activates the proteasome and promotes overall protein degradation by regulating USP14. Nat Commun. 2018 Mar 26;9(1):1223. doi: 10.1038/s41467-018-03499-z. PMID: 29581427; PMCID: PMC5964324. |