Primary Information |
|---|
| BoMiProt ID | Bomi5922 |
|---|
| Protein Name | Galactosylceramide sulfotransferase/GalCer sulfotransferase/3'-phosphoadenosine-5'-phosphosulfate:GalCer sulfotransferase/3'-phosphoadenylylsulfate:galactosylceramide 3'-sulfotransferase/Cerebroside sulfotransferase |
|---|
| Organism | Bos taurus |
|---|
| Uniprot ID | A6QNK1 |
|---|
| Milk Fraction | Whey,MFGM |
|---|
| Ref Sequence ID | NP_001095442.1 |
|---|
| Aminoacid Length | 423 |
|---|
| Molecular Weight | 48754 |
|---|
| FASTA Sequence |
Download |
|---|
| Gene Name | GAL3ST1 |
|---|
| Gene ID | 513295 |
|---|
| Protein Existence Status | reviewed |
|---|
Secondary Information |
|---|
| Protein Function | Involved in the development of cerebrum and cerebellum of mice.Catalyzes the synthesis of galactosylceramide sulfate (sulfatide), a major lipid component of the myelin sheath and of monogalactosylalkylacylglycerol sulfate (seminolipid), present in spermatocytes. |
|---|
| Biochemical Properties | This protein is involved in the pathway sphingolipid metabolism, which is part of Lipid metabolism. |
|---|
| Significance in milk | biosynthesis of sulfated glycans |
|---|
| PTMs | N-linked Glycosylation at Asn |
|---|
Site(s) of PTM(s)
N-glycosylation,
O-glycosylation,
Phosphorylation
| >sp|A6QNK1|G3ST1_BOVIN Galactosylceramide sulfotransferase OS=Bos taurus OX=9913 GN=GAL3ST1 PE=2 SV=1
MPLPQKKRWESMAKGLVLGALFTSFLLLLYSYAVPPLYTGLASTTPEGAAPCSPAPREPE
APTSAN*66GSAGGCQPRRDIVFMKTHKTASSTLLNILFRFGQKHGLKFAFPNGRNDFDYPAF
FARSLVQDYRPGACFNIICNHMRFHYDEVRGLVAPN*156ATFITVLRDPARLFESSFHYFGSV
VPFTWKLSGRDKLAEFLQDPDRYYDARGYNAHYLRNLLFFDLGYDSDLDPSSPQVQEHIL
EVERHFHLVLLQEYFDESLVLLKDLLCWELEDVLYFKLNARRASAVPRLSGELYRRATAW
NVLDARLYRHFN*312ASFWRKVEAFGRERMAREVAALRRANERMRRICIDGGRAVDAAAIEDS
AMQPWQPLGAKSILGYNLKKSIGQRHAQLCRRMLTPEIQYLMDLGANLWITKLWKFIRDF
LRW |
|---|
| Predicted Disorder Regions | (46-71) |
|---|
| DisProt Annotation | |
|---|
| TM Helix Prediction | 1TMH; (13-35) |
|---|
| Significance of PTMs | glycosylation has been found to be required for the correct subcellular targeting of some proteins, for the stabilization of enzymes, or to be directly involved in forming an active enzyme. |
|---|
| Additional Comments | The formation of sulphatide and seminolipid by the transfer of sulphate from adenosine 3-phosphate 5-phosphosulphate (PAPS) to galactocerebroside and galactosylalkylacylglycerol respectively is catalysed by the same enzyme, galactosylceramide sulphotransferase (CST), a Golgi type II membrane protein |
|---|
| Bibliography | 1.Eckhardt M, Fewou SN, Ackermann I, Gieselmann V. N-glycosylation is required for full enzymic activity of the murine galactosylceramide sulphotransferase. Biochem J. 2002 Nov 15;368(Pt 1):317-24. doi: 10.1042/BJ20020946. PMID: 12175333; PMCID: PMC1222978. 2.Burkart T, Wiesmann UN, Siegrist HP, Herschkowitz NN. Net sulfatide synthesis, galactosylceramide sulfotransferase and arylsulfatase A activity in the developing cerebrum and cerebellum of normal mice and myelin-deficient jimpy mice. Biochim Biophys Acta. 1981 Mar 18;673(3):351-8. doi: 10.1016/0304-4165(81)90466-9. PMID: 6112019. 3.Varki, A. (1993) Biological roles of oligosaccharides : all of the theories are correct.
Glycobiology 3, 97–130. |
|---|
