Primary Information |
|---|
| BoMiProt ID | Bomi7319 |
|---|
| Protein Name | Myotrophin |
|---|
| Organism | Bos taurus |
|---|
| Uniprot ID | Q3T0F7 |
|---|
| Milk Fraction | Exosomes |
|---|
| Ref Sequence ID | NP_976238.2 |
|---|
| Aminoacid Length | 118 |
|---|
| Molecular Weight | 12895 |
|---|
| FASTA Sequence |
Download |
|---|
| Gene Name | MTPN |
|---|
| Gene ID | 541099 |
|---|
| Protein Existence Status | Reviewed |
|---|
Secondary Information |
|---|
| Presence in other biological fluids/tissue/cells | occipital lobe |
|---|
| Protein Function | It may play a role in the initiation of cardiac hypertrophy as well as in normal growth of cardiac myocytes in humans. |
|---|
| PTMs | Phosphorylation at Thr,N-Acetylation at Lys |
|---|
Site(s) of PTM(s)
N-glycosylation,
O-glycosylation,
Phosphorylation
| >sp|Q3T0F7|MTPN_BOVIN Myotrophin OS=Bos taurus OX=9913 GN=MTPN PE=1 SV=3
MCDKEFMWALKNGDLDEVKDYVAKGEDVNRT*31LEGGRKPLHYAADCGQLEILEFLLLKGAD
INAPDKHHITPLLSAVYEGHVSCVKLLLSKGADKTVKGPDGLTAFEATDNQAIKALLQ
|
|---|
| Predicted Disorder Regions | NA |
|---|
| DisProt Annotation | |
|---|
| TM Helix Prediction | No TM helices |
|---|
| Bibliography | 1.Sil P, Misono K, Sen S. Myotrophin in human cardiomyopathic heart. Circ Res. 1993 Jul;73(1):98-108. doi: 10.1161/01.res.73.1.98. PMID: 8508536. 2. |
|---|
