Primary Information |
|---|
| BoMiProt ID | Bomi8057 |
|---|
| Protein Name | Platelet-activating factor acetylhydrolase IB subunit beta/Lissencephaly-1 protein(
LIS-1)/PAF acetylhydrolase 45 kDa subunit/PAF-AH alpha |
|---|
| Organism | Bos taurus |
|---|
| Uniprot ID | P43033 |
|---|
| Milk Fraction | Whey |
|---|
| Ref Sequence ID | NP_777088.1 |
|---|
| Aminoacid Length | 410 |
|---|
| Molecular Weight | 46613 |
|---|
| FASTA Sequence |
Download |
|---|
| Gene Name | PAFAH1B1/LIS1/PAFAHA |
|---|
| Gene ID | 282513 |
|---|
| Protein Existence Status | reviewed |
|---|
Secondary Information |
|---|
| Protein Function | Regulatory subunit (beta subunit) of the cytosolic type I platelet-activating factor (PAF) acetylhydrolase,an enzyme that catalyzes the hydrolyze of the acetyl group at the sn-2 position of PAF and its analogs and participates in the PAF inactivation. essential regulator of dynein-mediated motility, as well as mitosis, nuclear positioning, and microtubule organization. |
|---|
| Biochemical Properties | beta subunit is imp for catalytic activity. |
|---|
| Significance in milk | related to fertility |
|---|
| PTMs | Acetylation and phosphorylation |
|---|
Site(s) of PTM(s)
N-glycosylation,
O-glycosylation,
Phosphorylation
| >sp|P43033|LIS1_BOVIN Platelet-activating factor acetylhydrolase IB subunit beta OS=Bos taurus OX=9913 GN=PAFAH1B1 PE=1 SV=2
MVLSQRQRDELNRAIADYLRSNGYEAAYSVFKKEAELDMNEELDKKYAGLLEKKWTSVIR
LQKKVMELESKLNEAKEEFTSGGPLGQKRDPKEWIPRPPEKYALSGHRS*109PVTRVIFHPVF
SVMVSASEDATIKVWDYETGDFERTLKGHTDSVEDISFDHSGKLLASCSADMTIKLWDFQ
GFECIRTMHGHDHNVSSVAIMPNGDHIVSASRDKTIKMWEVQTGYCVKTFTGHREWVRMV
RPNQDGTLIASCSNDQTVRVWVVATKECKAELREHEHVVECISWAPESSYSSISEATGSE
TKKSGKPGPFLLSGSRDKTIKMWDVSTGMCLMTLVGHDNWVRGVLFHSGGKFILSCADDK
TLRVWDYKNKRCMKTLNAHEHFVTSLDFHKTAPYVVTGSVDQTVKVWECR
|
|---|
| Predicted Disorder Regions | 79-86, 296-307 |
|---|
| DisProt Annotation | |
|---|
| TM Helix Prediction | No TM helices |
|---|
| Significance of PTMs | phosphorylated on serine residues by a kinase associated with microtubules,probably affecting its catalytic function. |
|---|
| Bibliography | Sapir T, Cahana A, Seger R, Nekhai S, Reiner O. LIS1 is a microtubule-associated phosphoprotein. Eur J Biochem. 1999 Oct 1;265(1):181-8. doi: 10.1046/j.1432-1327.1999.00711.x. PMID: 10491172. |
|---|
