Primary Information |
|---|
| BoMiProt ID | Bomi8202 |
|---|
| Protein Name | Prefoldin subunit 4 |
|---|
| Organism | Bos taurus |
|---|
| Uniprot ID | Q2TBR6 |
|---|
| Milk Fraction | Whey,exosome |
|---|
| Ref Sequence ID | NP_001033629.1 |
|---|
| Aminoacid Length | 134 |
|---|
| Molecular Weight | 15328 |
|---|
| FASTA Sequence |
Download |
|---|
| Gene Name | PFDN4 |
|---|
| Gene ID | 514621 |
|---|
| Protein Existence Status | reviewed |
|---|
Secondary Information |
|---|
| Protein Function | binds and stabilizes newly synthesized polypeptides. |
|---|
| Biochemical Properties | Heterohexamer of two PFD-alpha type and four PFD-beta type subunits. |
|---|
| PTMs | Acetylation and phosphorylation |
|---|
Site(s) of PTM(s)
N-glycosylation,
O-glycosylation,
Phosphorylation
| >sp|Q2TBR6|PFD4_BOVIN Prefoldin subunit 4 OS=Bos taurus OX=9913 GN=PFDN4 PE=2 SV=1
MAATMKKAAAEDVNVTFEDQQKINKFARNTSRITELKEEIEVKKKQLQNLEDACEDIMLA
DDDCLMIPYQIGDVFISHSQEETQEMLEEAKKNLQEEIDALESRVESIQRVLADLKVQLY
AKFGS*125NINLEADES
|
|---|
| Predicted Disorder Regions | 1-21, 28-34, 78-92, 126-134 |
|---|
| DisProt Annotation | |
|---|
| TM Helix Prediction | No TM helices |
|---|
| Significance of PTMs | N-terminal acetylation may be for molecular function, for thermal stability or for efficient complex assembly. |
|---|
| Bibliography | Falb M, Aivaliotis M, Garcia-Rizo C, Bisle B, Tebbe A, Klein C, Konstantinidis K, Siedler F, Pfeiffer F, Oesterhelt D. Archaeal N-terminal protein maturation commonly involves N-terminal acetylation: a large-scale proteomics survey. J Mol Biol. 2006 Oct 6;362(5):915-24. doi: 10.1016/j.jmb.2006.07.086. Epub 2006 Aug 3. PMID: 16950390. |
|---|
