Primary Information |
|---|
| BoMiProt ID | Bomi9017 |
|---|
| Protein Name | Seminal plasma protein BSP-30 kDa |
|---|
| Organism | Bos taurus |
|---|
| Uniprot ID | P81019 |
|---|
| Milk Fraction | Whey |
|---|
| Ref Sequence ID | NP_777267.1 |
|---|
| Aminoacid Length | 183 |
|---|
| Molecular Weight | 21269 |
|---|
| FASTA Sequence |
Download |
|---|
| Gene ID | 317699 |
|---|
| Protein Existence Status | Reviewed |
|---|
Secondary Information |
|---|
| Presence in other biological fluids/tissue/cells | mammary gland fat |
|---|
| Protein Function | BSP-30K is a major acidic glycoprotein of bovine seminal plasma. It displays heparin-, gelatin-, and phospholipid-binding activities. BSP-30K binds to spermatozoa upon ejaculation and is thought to play a role in sperm capacitation. |
|---|
| Biochemical Properties | BSP-30K has a unique 48-residue N-terminal extension which includes three 7–8- amino acid repeats and the six O-glycosylated threonine residues. The polypeptide stretch 49–71 is homologous to type ‘A’ domains found in heparin-binding proteins from other mammalian species. The C-terminal portion of BSP-30K is organized in a tandem of 40–44-residue domains each sharing the consensus pattern of the gelatin-binding fibronectin type II module. |
|---|
| PTMs | Disulfide bond formation,O-Linked Glycosylation at Thr |
|---|
Site(s) of PTM(s)
N-glycosylation,
O-glycosylation,
Phosphorylation
| >sp|P81019|SFP4_BOVIN Seminal plasma protein BSP-30 kDa OS=Bos taurus OX=9913 PE=1 SV=2
MAPLVGLFLIWAGASVFQQLHPVNGGDIPDPGSKPT*36PPGMADELPT*46ETYDLPPEIYT*57T*58T*59F
LPRT*64IYPQEEMPYDDKPFPSLLSKANDLNAVFEGPACAFPFTYKGKKYYMCTRKNSVLLW
CSLDTEYQGNWKFCTERDEPECVFPFIYRKKSYESCTRVHSFFWRRWCSLTSNYDRDKAW
KYC
|
|---|
| Predicted Disorder Regions | 19-82 |
|---|
| DisProt Annotation | |
|---|
| TM Helix Prediction | No TM helices |
|---|
| Bibliography | 1.Calvete JJ, Mann K, Sanz L, Raida M, Töpfer-Petersen E. The primary structure of BSP-30K, a major lipid-, gelatin-, and heparin-binding glycoprotein of bovine seminal plasma. FEBS Lett. 1996 Dec 9;399(1-2):147-52. doi: 10.1016/s0014-5793(96)01310-5. PMID: 8980140. |
|---|
