Primary Information |
|---|
| BoMiProt ID | Bomi9056 |
|---|
| Protein Name | Serine/threonine-protein kinase RIO3/RIO kinase 3 |
|---|
| Organism | Bos taurus |
|---|
| Uniprot ID | Q1RMT7 |
|---|
| Milk Fraction | Whey |
|---|
| Ref Sequence ID | NP_001069304.1 |
|---|
| Aminoacid Length | 519 |
|---|
| Molecular Weight | 58928 |
|---|
| FASTA Sequence |
Download |
|---|
| Gene Name | RIOK3 |
|---|
| Gene ID | 522917 |
|---|
| Protein Existence Status | reviewed |
|---|
Secondary Information |
|---|
| Protein Function | known to be involved in the phosphorylation-mediated regulation of a wide variety of cellular processes,RIOK3 as a novel adaptor protein that is essential for the cytosolic nucleic acid-induced type I IFN production and for the antiviral response to gammaherpesvirus through two independent kinome-wide RNA interference screens. |
|---|
| Biochemical Properties | RIOK3 physically interacts with TBK1 and IRF3 and bridges the functions between TBK1 and IRF3 in the activation of type I interferon pathway. |
|---|
| PTMs | Phosphorylation at Ser and Tyr |
|---|
Site(s) of PTM(s)
N-glycosylation,
O-glycosylation,
Phosphorylation
| >sp|Q1RMT7|RIOK3_BOVIN Serine/threonine-protein kinase RIO3 OS=Bos taurus OX=9913 GN=RIOK3 PE=2 SV=1
MDLVRVASPEPGPAAAWGPNKCPWATPQNTISCSLSDVMSEQLAKELQLEEEAAAFPEVT
VAEGPFITGENIDTSSDLMLAQMLQMEFDREYDAQLRREEKKFNGDSKVCIS*112FENYRKVH
PY*122EDS*125DS*127S*128EDEVDWQDTRDDPYRPAKPIPTPKKGFIGKGKDITTKHDEVVCGRKNTARMENFAPGFQVGDGIGMDLKLSNHVFNALKQHAYSEERRSARLHEKKEHSTAEKAVDPKTRLL
MYKMVNSGMLETITGCISTGKESVVFHAYGGSMEDGKEDSKVIPTECAIKVFKTTLNEFK
NRDKYIKDDFRFKDRFSKLNPRKIIRMWAEKEMHNLTRMQRAGIPCPTVVLLKKHILVMS
FIGHDQVPAPKLKEVKLSSEEMKDAYYQTLHLMQQLYDECTLVHADLSEYNMLWHAGKVW
LIDVSQSVEPTHPHGLEFLFRDCRNVSQFFQKGGVKEALGERELFNAVSGLNISADNEAD
FLAEIEALEKMNEDHVQKNGRKAASFLKDDGGPPILYDE |
|---|
| Predicted Disorder Regions | 6-29, 56-64, 120-169, 510-519 |
|---|
| DisProt Annotation | |
|---|
| TM Helix Prediction | No TM helices |
|---|
| Significance of PTMs | There is an evidence that RIOK3 can undergo autophosphorylation |
|---|
| Additional Comments | Unlike RIO1 and RIO2, RIO3 was only discovered in the multicellular eukaryotes, and the biological function of human RIOK3 remains largely unknown |
|---|
| Bibliography | 1.Feng J, De Jesus PD, Su V, Han S, Gong D, Wu NC, Tian Y, Li X, Wu TT, Chanda SK, Sun R. RIOK3 is an adaptor protein required for IRF3-mediated antiviral type I interferon production. J Virol. 2014 Jul;88(14):7987-97.doi: 10.1128/JVI.00643-14. Epub 2014 May 7. PMID: 24807708; PMCID: PMC4097797. 2.Anaya P, Evans SC, Dai C, Lozano G, May GS. 1998. Isolation of the Aspergillus nidulans sudD gene and its human homologue. Gene 211:323–329. http://dx.doi.org/10.1016/S0378-1119(98)00115-2. 3.Shan J, Wang P, Zhou J, Wu D, Shi H, Huo K. 2009. RIOK3 interacts with caspase-10 and negatively regulates the NF-B signaling pathway.Mol. Cell. Biochem. 332:113–120. http://dx.doi.org/10.1007/s11010-009-0180-8. |