Primary Information |
|---|
| BoMiProt ID | Bomi9678 |
|---|
| Protein Name | Syntaxin-17 |
|---|
| Organism | Bos taurus |
|---|
| Uniprot ID | Q5E9Y2 |
|---|
| Milk Fraction | Whey |
|---|
| Ref Sequence ID | NP_001029778.1 |
|---|
| Aminoacid Length | 302 |
|---|
| Molecular Weight | 33559 |
|---|
| FASTA Sequence |
Download |
|---|
| Gene Name | STX17 |
|---|
| Gene ID | 534304 |
|---|
| Protein Existence Status | reviewed |
|---|
Secondary Information |
|---|
| Presence in other biological fluids/tissue/cells | localized to the nucleus in normal pancreatic ductal epithelial, acinar, and islet cells |
|---|
| Protein Function | autophagosomal SNARE protein that mediates autophagosome maturation,also autophagosome-lysosome fusion |
|---|
| PTMs | phosphorylation on Ser and Tyr.Acetylation on Lys |
|---|
Site(s) of PTM(s)
N-glycosylation,
O-glycosylation,
Phosphorylation
| >sp|Q5E9Y2|STX17_BOVIN Syntaxin-17 OS=Bos taurus OX=9913 GN=STX17 PE=2 SV=1
MSEDEEKVKLRRLEPAIQKFTKIVIPTDLERLRKHQINIEKYQRCRVWDKLHEEHINAGR
TVQQLRSNIREMEKLCLKVRKDDLGLLKRMIDPVKEEASAATAEFLQLHLESVEELKKQF
NDEETFLQPSLTRSMTVGGTFHSTEDEADPQSMTQIY*157ALPEIPRDQNAAESWETLEADLI
ELSQLVTDFSLLVNSQQEKIDSIEDHVNTAAVNVEEGTKNLGKAAKYKLAALPVAGALIG
GVVGGPIGLLAGFKVAGIAAALGGGVLGFTGGKLIQRRKQKMMEKLASS*289CPDLPSQTDKK
CS
|
|---|
| Predicted Disorder Regions | 136-157, 277-302 |
|---|
| DisProt Annotation | |
|---|
| TM Helix Prediction | 2TMHs ; (229-251) , (257-275) |
|---|
| Significance of PTMs | histone acetyltransferase CREBBP/CBP and the deacetylase HDAC2 specifically regulate the acetylation of STX17.deacetylated at K219 and K223 during autophagy.phosphorylation of SNAP25 at S187 site, which is also facing the outside of the alpha-helical bundle of the STX1A-SNAP25-VAMP2/Synaptobrevin 2 SNARE complex, increases the binding of SNAP25 to STX1A and promotes the SNARE complex formation deacetylation of STX17 is required for STX17 to assemble the STX17-SNAP29-VAMP8 SNARE complex and to recruit the HOPS complex, both essential for autophagosome-lysosome fusion. |
|---|
| Bibliography | Shen Q, Shi Y, Liu J, Su H, Huang J, Zhang Y, Peng C, Zhou T, Sun Q, Wan W, Liu W. Acetylation of STX17 (syntaxin 17) controls autophagosome maturation. Autophagy. 2021 May;17(5):1157-1169. doi: 10.1080/15548627.2020.1752471. Epub 2020 Apr 15. PMID: 32264736; PMCID: PMC8143222. |