Primary Information |
|---|
| BoMiProt ID | Bomi8323 |
|---|
| Protein Name | Protein chibby homolog 2/Spermatid-associated protein |
|---|
| Organism | Bos taurus |
|---|
| Uniprot ID | A6QQS3 |
|---|
| Milk Fraction | whey |
|---|
| Ref Sequence ID | NP_001095767.1 |
|---|
| Aminoacid Length | 455 |
|---|
| Molecular Weight | 52473 |
|---|
| FASTA Sequence |
Download |
|---|
| Gene Name | CBY2/SPERT |
|---|
| Gene ID | 616053 |
|---|
| Protein Existence Status | Reviewed |
|---|
Secondary Information |
|---|
| Protein Function | CBY2 is a testis-specific leucine-zipper protein that interacts with NEK1 during late spermatid maturation. |
|---|
| Biochemical Properties | contain an N-terminal leucine-zipper motif, 2 C-terminal coiled-coil regions, and several phosphorylation sites. |
|---|
| PTMs | Phosphorylation |
|---|
| Additional Comments | In situ hybridization, immunofluorescence analysis, and immunoelectron microscopy showed that Cby2 was expressed in inner cell layers within seminiferous tubules and formed large aggregates in flower-like structure organelles in cytoplasm. |
|---|
| Linking IDs | Bomi8323 |
|---|
| Bibliography | Chen, S. Z., & Zheng, L. Z. (2021). SPERT gene silencing inhibits the growth of human colon cancer xenograft tumor in nude mice via p38MAPK/HSP27 signaling pathway. Biomedical research (Tokyo, Japan), 42(6), 247–255. https://doi.org/10.2220/biomedres.42.247 |
|---|
| Protein Function | CBY2 is a testis-specific leucine-zipper protein that interacts with NEK1 during late spermatid maturation. |
|---|
| Biochemical Properties | contain an N-terminal leucine-zipper motif, 2 C-terminal coiled-coil regions, and several phosphorylation sites. |
|---|
| PTMs | Phosphorylation |
|---|
Site(s) of PTM(s)
N-glycosylation,
O-glycosylation,
Phosphorylation
| >sp|A6QQS3|CBY2_BOVIN Protein chibby homolog 2 OS=Bos taurus OX=9913 GN=CBY2 PE=2 SV=2
MSPLECSECFGDQLLHRTYTWHLTLHSRPNFTRKRDTRSES*41LEIPINVVLPQRGTAEPFL
RLHNLYPTPRCARQAALPRLSRRVVS*86QHS*89YPLNRFSS*97VPLDPMERPTSQADLELDYNPPR
VQLS*124DEMFVFQDGRWVSENCRLQS*144PYFS*148PS*150SSFHHKLHHKRLAKECLLQENKTLREENRALREENRMLRKENKILQVFWEEHQAALGRDDS*211RASSPLLHKDNASS*225LEAMKKETALQAHRGRENSTLQLLREENRALQQLLEQRKAYWAQPDEKAAS*276TEEIKPISSPHEEPHGLLPDPGPG
LPSPFEEPKGLPAPPDDSKTLRALREMVSTLS*332AQPGEEVGKGGPGLPDGSQSLELLREMN
QALQALREENQSLQVLRDENRLLQEENRALHALREEHRLFQEENKALWENNKLKLQQKLV
IDTVTEVTARMEMLIEELYAFMPAKSKDPKKPSRV
|
|---|
| Predicted Disorder Regions | 95-118, 209-320, 330-409, 444-451 |
|---|
| DisProt Annotation | |
|---|
| TM Helix Prediction | No TM helices |
|---|
| Additional Comments | In situ hybridization, immunofluorescence analysis, and immunoelectron microscopy showed that Cby2 was expressed in inner cell layers within seminiferous tubules and formed large aggregates in flower-like structure organelles in cytoplasm. |
|---|
| Linking IDs | |
|---|
| Bibliography | Chen, S. Z., & Zheng, L. Z. (2021). SPERT gene silencing inhibits the growth of human colon cancer xenograft tumor in nude mice via p38MAPK/HSP27 signaling pathway. Biomedical research (Tokyo, Japan), 42(6), 247–255. https://doi.org/10.2220/biomedres.42.247 |
|---|
